SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011055 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011055
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.62e-66
Family LplA-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011055   Gene: ENSCPOG00000012292   Transcript: ENSCPOT00000012408
Sequence length 373
Comment pep:known scaffold:cavPor3:scaffold_24:3138471:3139592:1 gene:ENSCPOG00000012292 transcript:ENSCPOT00000012408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFLMKNCFQLLCTHKVPAAGFKNAVKSGLILQSVSSDVYQNLAVEDWIHDHVNLEGK
PILFFWRNTPSLVIGRHQNPWQECNLSLMRERGVKLARRLSGGGAVYHDMGNINLTFFTT
RTKYDRMENLKLIVRALNAIQPQLDVQATKRFDLLLDGQFKISGTAAKIGRTTAYHHCTL
LCSTDRTSLSSLLKSPYQGIKSNATQSIPAMVKNLLEKDPTLTCEGLINAIAAEYAAHHQ
IDHHITFINPTDETLFPGINSRAKELQTWEWIYGRTPKFSISTAFNVLGEQTPLEIKVFL
DIKNGRIEICRIEAPYHWLPLEIYEKLNSGLTGSKFCPVETTMITHMLLRTCPEDQELHS
KWNVLCEKIKGIM
Download sequence
Identical sequences XP_003471612.1.53824 XP_013010005.1.53824 XP_013010006.1.53824 ENSCPOP00000011055 10141.ENSCPOP00000011055 ENSCPOP00000011055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]