SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011092 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011092
Domain Number 1 Region: 12-103,173-254,512-758
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.76e-91
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0032
Further Details:      
 
Domain Number 2 Region: 281-406,473-511
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.05e-29
Family ValRS/IleRS/LeuRS editing domain 0.0037
Further Details:      
 
Domain Number 3 Region: 765-990
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.14e-28
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011092   Gene: ENSCPOG00000012329   Transcript: ENSCPOT00000012446
Sequence length 1178
Comment pep:known scaffold:cavPor3:scaffold_6:8266843:8322220:-1 gene:ENSCPOG00000012329 transcript:ENSCPOT00000012446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERKGTAKVDFLKKIEKEIQQKWEAEKVFEVNASDLEKQSRHNNFKYFVTFPYPYMNGRLH
LGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDE
EEEEEEISVKTENTVVKDKAKGKKSKAAAKAGSSKYQWGIMQSLGLSDEEIVKFSEAEHW
LDYFPPLAIQDLKRIGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIY
SPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMF
GQTNCWVHPDIKYIGFETVNGDIFICTQRAARNMSYQGFTKDNGVVPVVKELMGEEILGA
SLSAPLTSYEVIYLLPMLTIKEEKGTGVVTSVPSDSPDDVAALRDLKKKQALRAKYGIRD
EMVFPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLTEAKEKLYLKGFYEGIMLVD
EFKGQKVQDVKKTIQKKMIDAGDAYIYMEPEKQVISRSSDECVVALCDQWYLDYGEENWK
KQTSQCLTNMETFCEETRRNFEASLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIY
MAFYTVAHLLQGGNLHGQAESPLGIRPQQLTKEVWDYIFFKDAPFPQTQISKEKLDQLKH
EFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWQEQSDKWPKAVRANGHLLLNSEKMSKS
TGNFLTLSQAVDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLAN
RDSLRSGPANTFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAI
EGMHRELVFRFIEVQTLVLAPFCPHLCEHIWTLLGKKSDSVMNASWPVAGPVDEILIRSS
QYLMEVAHDLRLRLKNYMVPAKGKKTDQQPPQRPSHCTIYVAKDYPPWQHTTLTFLRNHF
EVNNGRLPDNKLIASELGSMPELKKYMKKVMPFVAMVKENVEKMGPRVLDLQLEFDEQAV
LMENAVYLTNSLELEHIEVKFASEADDKIREDCCPGKPLTVFRTEPGVPVSLVNPQPSNG
HFSTKIEVRQGDNSDSIIRRLMKMDRGIKVDLSQVKLMRFDDPVLGPRRVPVLGKEHTEK
TPISEHAVFHVDLTSKKIHLTENGLRADIGDTIIYLVH
Download sequence
Identical sequences ENSCPOP00000011092 ENSCPOP00000011092 10141.ENSCPOP00000011092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]