SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011124 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011124
Domain Number 1 Region: 789-906
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-35
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011124
Domain Number - Region: 62-159
Classification Level Classification E-value
Superfamily CoA-transferase family III (CaiB/BaiF) 0.0314
Family CoA-transferase family III (CaiB/BaiF) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011124   Gene: ENSCPOG00000012362   Transcript: ENSCPOT00000012480
Sequence length 917
Comment pep:known scaffold:cavPor3:scaffold_4:12079446:12096967:-1 gene:ENSCPOG00000012362 transcript:ENSCPOT00000012480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEALAGLDEGALRKLLEVTSDLAERRRIRSAIRELQRQELEREEEALASKRFRAERQD
NKENWLHSQHREAEQRAALAQLAKQLESMNDVEELTTLLRSAGEYEERKLIRAAIRRVRA
QEIEAATVAGRLCSGRPNSSSREESKEQAAHRLEQCEVPEHKEQEQQTEVSEPTPTPEDT
SQDVTTVTLLLRPPPGDTPSSTASPDNSPSTASPEPPLELAGAQCAAAEAPGDPEPPPRT
PRTPTPELPESLAQPNMERQAANKLLPGSTEPPAAQSPTRGPSNKNRADLAGPQPCQRSL
SVLSPRQPTQNQESTPLGIGHSPFHRAGSVRDRVRKFASDSPMAARLHDGPTRATLGSPT
PTRLLGSSVIISTTPASSSRSSSSRGPSNTSSESSKEQRGTTQPLAQLQSCPQEEGPRGR
GLAARSLENRAGEPVACSEEPSAPLPVAVSAAEPGGSMKTTFTIEIKDGRGQASTGRVLL
PTSNQRAELTLGLRTPPTLLNTGSGNKSTITHVSSPGTLTRMGGVTQVTTFSHASPGSRR
GCSTKMEPEPVQPPFTAVEAANGAEKTQVDKAPQGQSPLSTEELMAIEDEGVLDKMLDQS
TDFEERKRIRAALRELRQRKRDQRDKEREQRLQEARGRPGERRSNTSTEMTTTHSQRAAD
GSAVSTVTKTERLVQSNDGTRTARTTTVESSFVRRSENGSGSTTVQTKTFSSSSSSSKKM
GSIFDREDQASPRSGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGTSG
SPGGPRTGVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALV
HNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQ
EFYRCLVQKGLVKTKKS
Download sequence
Identical sequences H0VL97
10141.ENSCPOP00000011124 ENSCPOP00000011124 XP_003478354.1.53824 ENSCPOP00000011124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]