SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011241 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011241
Domain Number 1 Region: 306-539
Classification Level Classification E-value
Superfamily Caspase-like 5.23e-39
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily DEATH domain 2.59e-23
Family DEATH domain, DD 0.0046
Further Details:      
 
Domain Number 3 Region: 95-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000551
Family I set domains 0.053
Further Details:      
 
Domain Number 4 Region: 201-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000124
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011241   Gene: ENSCPOG00000012493   Transcript: ENSCPOT00000012612
Sequence length 804
Comment pep:novel scaffold:cavPor3:scaffold_14:6813476:6884516:-1 gene:ENSCPOG00000012493 transcript:ENSCPOT00000012612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTVNHLQEPLLRRLSECLDRAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGS
PSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITKNPESKAVLAGQFVKLC
CRATGHPFVQYQWFKMNKEIPYGNASELIFNSVSVKDAGFYVCRVNNNSTFEFSQWSQLD
VCEVTEVTETFQKNGDGIPESKLQICVEPKSQKLMPGTTLILQCVAIGSPIPHYQWFKNE
SPLTHETKKIYMVPYVDLEHQGTYWCHVYNDRDSQDSVKVEIIIGRTDEAVECTEDMFCF
YLDIDNKDQTTDQSLAKDKVALLIGNMNYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLL
DLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQN
ILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHS
GLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPI
QGAAASAESLVRNLQWAKAHELPESMCLQFQCGVRIQLGFAAEFSNVMIIYTSIVHKPPE
IVMCDAYVTDFPLDLDIDPKDANKGSPEETGSYLVSKELPKHCLYTRLSSLQKLKEHLIF
TVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGLGRKTCYQTCLMSDGPFHSSTPTS
GAAGRYPSSQGSFHGVYHSHLANSESIVPSERCHCSRTPNASNAFISSYHPHHYSCGLGR
SNVPVETTDEMPFSVSDGLRISEK
Download sequence
Identical sequences ENSCPOP00000011241 ENSCPOP00000011241 10141.ENSCPOP00000011241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]