SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011348 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011348
Domain Number 1 Region: 962-1067
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-31
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011348
Domain Number - Region: 682-774
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00144
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011348   Gene: ENSCPOG00000012614   Transcript: ENSCPOT00000012735
Sequence length 1069
Comment pep:known scaffold:cavPor3:scaffold_61:671308:877477:1 gene:ENSCPOG00000012614 transcript:ENSCPOT00000012735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAAKPWNPVVKAGTHCSDRARPLPAASSGMKNSKSSTSLAFESRLSKLKRASSEDMLN
KPGSTSSSGVARLKKTATSGAISELAESRLRTTAGRIPTTKRTGIPAPRELSVTVSRERS
VPRGPSNPKKSGSSPTSSCTHTPTKHLRTTSTKLKQDNEAGEKAVLESQVRELLAEAKAK
DSEINRLRSELKKCKERRALSTEGTEASDPSSDGASALPGDTEPLIRTLEEKNKTFQKEL
ADLEEENRVLKEKLTYLEQSPHSEGAASHTGDSSCPTSVTQESSFGSPIGNELSSEIDEY
KKNTYGNTLRTSGSSSSDVTKASLSPDASDFEHITTDSLSRPLSSSSNPFKNSKCSTTGS
SPNNASELSLASLTEKIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKT
ILETSFHQHRERAEQLSQENEKLINLLQERVKNDEPSAQEGKILELEQKCTDILEKSHFE
REKLLNIQQQLTCSLRKAEEENQGALDMIKHLKEENEKLNGFLERERCSNSAMTKTLEEC
RVTLEGLKMENGSLKAHLEGEKQKASETSSALGQTAENCELQEMLKVAQAEKDQLEQSCT
ELRQELLKANGEIKHISSLLAKMEKDYSYLKDICDHQAEQLSRTSLKLQEKASESDAEIK
DMKETIFELEDQVEQHRAVKLHNNQLISELESNVIKLEEQKSDLERQLKTLTKQIKEETE
EWRRFQADLQTAVVVANDIKCEAQQELRTVKRRLLEEEEKNARLQKELGDMQGHSRWVTG
RVMSLPVNEEPESLEVNSAGRWHGVYVNRTSAAPSESATTVKSLIKSFDLGHPGGTGQNI
SIHKAPRSPLSGIPVRTTPAAAVSPMQRHSTYNSLRPASKGMTQRLDIPDLPLSDLLKGR
TEDLKPDPYLRKSPSLESLSRPPSLGFGSTRLLSASTGGLKPPSKLSVERRDPLAALARE
YGGSKRNALLKWCQKKTEGYANIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQEK
KRNLLLAFEAAESIGIKPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET
Download sequence
Identical sequences ENSCPOP00000011348 10141.ENSCPOP00000011348 ENSCPOP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]