SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011585 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011585
Domain Number 1 Region: 46-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-78
Family Protein kinases, catalytic subunit 0.000000506
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000232
Family Regulator of G-protein signaling, RGS 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011585   Gene: ENSCPOG00000012872   Transcript: ENSCPOT00000012997
Sequence length 391
Comment pep:known scaffold:cavPor3:scaffold_166:1693885:1720130:-1 gene:ENSCPOG00000012872 transcript:ENSCPOT00000012997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNCVPSFSSIVHKYLSKKPFEEYQESPYFSRFLQWKWLERQPVTRKTFRHYRVLGKGGFG
EVCACQVRATGKMYACKKLEKKRIKKRRGEAMALNEKRLLEKVHSRFVVSLAYTYETKET
LCLVLTIMNGGDLKFHIYNLGNPGFDEKRAIFYAAEVCCGLEDLQKERIAYRDLKPENIL
LDDHVYIRISDLGLAVEVPEGQMVRGRVGTVGYMAPEVINNEKYTFSPDWWGLGCLIYEM
IQGHCPFRKPKEKVKREEVERRVRKDTEEYSDKFSEDAESICRMLLAKDPSERLGCRGDG
ATGVKKHPVFKDINFSRLEANMVEPPFRPDPNAVYCKDVLDIGRFSVVKGVNLDTTDDNF
YAQFATGCVSIPWQKEMIESGCFKEINDSEN
Download sequence
Identical sequences ENSCPOP00000011585 ENSCPOP00000011585 10141.ENSCPOP00000011585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]