SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011610 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011610
Domain Number 1 Region: 30-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-39
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000105
Family VWC domain 0.012
Further Details:      
 
Domain Number 3 Region: 427-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000652
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 479-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family EGF-like domain of nidogen-1 0.065
Further Details:      
 
Domain Number 5 Region: 334-392
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000429
Family VWC domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011610
Domain Number - Region: 514-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00512
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011610   Gene: ENSCPOG00000012897   Transcript: ENSCPOT00000013022
Sequence length 548
Comment pep:known scaffold:cavPor3:scaffold_131:1127292:1691930:-1 gene:ENSCPOG00000012897 transcript:ENSCPOT00000013022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMDVLLVVGFCVCTARTVVGSGLDPDLQMDIISELDLGNTTRGITQVSGQHNGSKAFLF
QDTGREIHAAPHVSEKLIQLFQNKSEFTFLATVQQKSLTSGVILSIGDLEHSYFELESSG
LRDAIRYHYMHKGRPRTEALPYRMADGQWHKVALSVSTSHLLLHVDCSRIYERVIDPPET
SFPPGSNLWLGQRNQKHGLFKGVIQDGRIIFMPNGYITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNHAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
VVECRRMSCPPLNCSPDALPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKICQECRGGA
LVKITETCPPLNCSEKDHILPENQCCRVCRGHNFCMEAPKCGENSECKNWNTKATCECKS
GYISVQGDPAYCEDIDECTAKMHYCHANTVCVNLPGLYRCDCIPGYIRVDDFSCTENDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNTCACPSG
FTGSHCEK
Download sequence
Identical sequences H0VMI0
ENSCPOP00000011610 ENSCPOP00000011610 10141.ENSCPOP00000011610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]