SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011651 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011651
Domain Number 1 Region: 60-260,463-719
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.69e-120
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000265
Further Details:      
 
Domain Number 2 Region: 263-463
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.15e-41
Family ValRS/IleRS/LeuRS editing domain 0.0000373
Further Details:      
 
Domain Number 3 Region: 725-1007
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 5.05e-37
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011651   Gene: ENSCPOG00000012942   Transcript: ENSCPOT00000013067
Sequence length 1009
Comment pep:novel scaffold:cavPor3:scaffold_13:2504462:2538385:-1 gene:ENSCPOG00000012942 transcript:ENSCPOT00000013067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHWGLCACRPGAAPLASARSRWGPPWSPRRPGPLGAAASFPVRGVSGAGDPAASPDRGRY
RDTVLLPRTAFPMRLPGRRQPDTELEIQQKCGFSELYSWQRERKAKTEFCLHDGPPYANG
DPHIGHALNKILKDIANRFHMMRGSKIHFVPGWDCHGLPIESKVLSELGGKAQNLSPMEI
REKARSFAKAAIEKQKSAFIRWGIMADWNNCYYTFDGEYEARQLRIFYKMYDKGLVYRSY
KPVFWSPSSRTALAEAELEYNPEHTSRSVYVKFPLRTPPPKLASLLDGSPAASVLVWTTQ
PWTVPANQALCYSPQSKYAVVKCSTSGNRYIVAADKVAPLGSTLDTTLEVIATFSGVDLE
DGTCSHPLIPDKVSPLLPATHVTMAKGTGLVHTAPAHGMEDYGVASQHSLPVDCSVDEGG
TFTAAAGPELEGKAVLEEGTDMVIKMLQHAKSLLKEEKLIHSYPYDWRTKKPIIIRASKQ
WFVKISDIKPTAKEVLKTVKFIPGSALNAMVDMLERRPYWCISRQRAWGVPIPVFLHRTK
DECLINSQTVEHVARLVEQHGSDVWWTLPPEQLLPQEVLSQVGGPDGLEYLPGQDILDIW
FDSGTSWASVLPGPDSRADLYLEGKDQLGGWFQSSLLTSIAARKKAPFKAVLVHGFTLGE
KGEKMSKSLGNVIDPDVVIHGGQDESAEPPFGADILRWWVAESNVFTEVTLGPSALSAAR
EDISKLRNTLRFLLGNLAGFNPQTDSVPVDGMYVLDQYMLHLLQSLATKLQPLCAGRDTG
GQCPVVRVCLPRGAESAVLKVVLYCEREDDPKRRSCQTALAQILDVLTRAFAPVLPHLAE
EVFQHLPYGAEPRSVFRTGWISASTIWKKPGLEEAVEGACAMRDAFLGSIPGRNAAEYEV
TVVIEPGLLFEIIEMLQAEETSSSSQLSELMMASRCTLLAQEPLQRPEDVTELGGTFLIN
LEGGDIREEASYKVLVTPATQEKCPRCWKYTAEAADTLCPRCAEVVGQA
Download sequence
Identical sequences 10141.ENSCPOP00000011651 ENSCPOP00000011651 ENSCPOP00000011651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]