SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011665 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011665
Domain Number 1 Region: 1871-2115
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.57e-54
Family Ankyrin repeat 0.000000058
Further Details:      
 
Domain Number 2 Region: 1170-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 3 Region: 411-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000529
Family EGF-type module 0.00031
Further Details:      
 
Domain Number 4 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000628
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000203
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 7 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.00054
Further Details:      
 
Domain Number 8 Region: 490-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000803
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 9 Region: 528-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000837
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 10 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000985
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 980-1102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 12 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000261
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 13 Region: 141-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000821
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 14 Region: 1145-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 562-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 16 Region: 177-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000894
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 17 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 295-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 19 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000657
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 20 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000748
Family EGF-type module 0.029
Further Details:      
 
Domain Number 21 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000976
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 22 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000148
Family EGF-type module 0.012
Further Details:      
 
Domain Number 23 Region: 1529-1561
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 24 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0052
Further Details:      
 
Domain Number 25 Region: 1393-1430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000572
Family EGF-type module 0.018
Further Details:      
 
Domain Number 26 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000719
Family EGF-type module 0.011
Further Details:      
 
Domain Number 27 Region: 1114-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.02
Further Details:      
 
Domain Number 28 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.00017
Further Details:      
 
Domain Number 29 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.057
Further Details:      
 
Domain Number 30 Region: 1348-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011665
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000742
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011665   Gene: ENSCPOG00000012958   Transcript: ENSCPOT00000013083
Sequence length 2548
Comment pep:known scaffold:cavPor3:scaffold_18:39066138:39103640:-1 gene:ENSCPOG00000012958 transcript:ENSCPOT00000013083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAPGAPCWCRLLLYAPAARGLRCSQPGTCENGGRCEVLNGTEACICSGDFVGQRCQDP
NPCLSAPCKNAGTCHMVDQGGTVDYTCSCSLGFSGPLCLTPLDNACLSGPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGHCLPFESTYICGCRPGFHGSTCRQDVN
ECSQTPGLCRNGGTCHNEVGSYRCACRPTHMGSNCELPYVPCSPSPCQNGGTCRPTGETT
HECACLPGFTGQNCEDNVDDCPGNSCRNGGACVDGVNTYNCRCPPEWTGQFCTEDVDECQ
LMPNACQNGGTCHNTQGGYNCVCVNGWTGEDCSENIDDCASAACFNGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCINTLGSFECQCLQGYSGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGLYCEVNTDECASSPCLHNGRCLDRVSEFLCECPTGFSGHLCQYDVDECASTPCRNG
AKCLDGPNTYSCVCTEGYTGIHCEVDINECDPDPCHYGSCKDGVAAFTCLCQPGYTGHHC
ETNINECASQPCRHGGTCQDRDNAYLCLCLKGTTGPNCEINLDDCASSPCDAGTCLDKID
GYECACEPGYTGSMCNINIDECAGSPCHNGGTCEDGINSFTCRCPEGYHDPTCLSEVNEC
SSNPCIHGSCQDSLNGYWCDCDSGWSGTNCDINNNECESNPCVNGGTCRDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGTTCEVVLAPCAPSPCKN
SGVCRESEDYESFSCICPSGWQGQTCEVDINECVKSPCRHGASCQNTNGDYRCHCQAGYT
GRDCETDVDDCRPNPCHNGGSCTDGVNTAFCDCLPGFQGAFCEEDINECASSPCRNGANC
TDCVDSYTCTCPAGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DINECDSRPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGQCWQTSTL
YRCECHSGWTGLYCDVPSVSCKVAAQQRDIDVAYLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEEEVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGTNCSEETNECLSQPCQNGGTCID
LTNTYKCSCPRGTQGVHCEINVDDCSPLHDLASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVIDGCKGKPCRNGG
VCAVATNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGAFTG
PECQFPASSPCMGDNPCYNQGTCEPTAESPFYRCLCPAKFNGLQCHILDYSFVGGAGRDI
PPPEVEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCSQSLQCWKYF
SDGRCDSQCNSAGCLFDGFDCQHAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLLPPEQLRNNSFHFLRELSRVLHTNVVFKRDAQGQQMIFPYY
GREEELRKHPIKRSAPGWATPGSLLGQAAASLLTSEGPGRQRRELDPMDIRGSIVYLEID
NRQCVQLSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPSQLHLMYLIG
AAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNVS
DGALMDDNQNEWGDEDLEAKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPT
PPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLH
NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILI
RNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNV
DAALVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIA
QERMHHDIVRLLDEYNLVRSPQLHNAALGSTPTLSPTLCSPNGYLGNLKPAMQGKKARKP
STKGLACGSKEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPS
PFQPSPSLPLSHLPGMPDAHLGINHLNVTAKPEMAALGGGSRLFEPGPPRLSHLPVASST
STVLGASSSGAVNFTVGTAAGLNGQCDWLSRLQNGMVSGQYNPLRGAVAPGTLSTQAPTL
QHGMMGPLQSGLSTNTLSQMMNYQGLPSTRLATQPHLVQAQQVQPPNLQPPPNIQQPQSL
QPQLPPSQPHLGVGSVANGHLGRSFMGGEPSQADVQPLGPNSLTVHTILPQEGQNLPTSM
PSSLVPPMTTAQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHS
NISDWSEGISSPPTSMQSQITHIPEAFK
Download sequence
Identical sequences ENSCPOP00000011665 10141.ENSCPOP00000011665 ENSCPOP00000011665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]