SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011703 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011703
Domain Number 1 Region: 1931-2213
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.95e-77
Family Protein kinases, catalytic subunit 0.000000238
Further Details:      
 
Domain Number 2 Region: 109-287
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-25
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 1655-1844
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-23
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 4 Region: 947-1145
Classification Level Classification E-value
Superfamily Fibronectin type III 6.41e-18
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 1150-1420
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000327
Family YWTD domain 0.0098
Further Details:      
 
Domain Number 6 Region: 563-663
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000333
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 7 Region: 672-896
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000471
Family YWTD domain 0.0033
Further Details:      
 
Domain Number 8 Region: 1452-1595
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000984
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 9 Region: 327-524
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000144
Family YWTD domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011703   Gene: ENSCPOG00000012998   Transcript: ENSCPOT00000013124
Sequence length 2345
Comment pep:known scaffold:cavPor3:scaffold_1:72721621:72860911:-1 gene:ENSCPOG00000012998 transcript:ENSCPOT00000013124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPITGEGMKLVGFTALGSVWISVAQCTILNTCLKSCVTNLGEQPDLGTPHNLSGPCIQGC
HLWSSVDQENCAVKCNDTYVAICEREACEVGCSSAEGAYEEEVLENTNLPTAPFASSIRS
HSITLRWKSANISEVKYIIQWKYAQLPGSWIYTETVSKLSYIMQALHPFTEYVFRVVWVF
TAQLQLSSPPSPSYRTHPRGVPETAPFIRNIESSGPDTVEVSWTPPQFPGGPILGYNLRL
ISKYNKFDSGTQRTSFQFYSTLPNTTYRFFVAAVNEAGEGPEAESSITTASVAVQEEEQW
LFLSRKMSLRKRSLKHLVDEAHCLWSDAIHHNITGISVHVHWQIVYFSEGTHIWMKEAVH
MSNVSDLRVFYRGSGLISSISTDWLYQRMYFIMNDLVYVCDLESCSNFEEITPPSIITPQ
KLVADAYNGYIFYLLRNGIHRVDLPTPSGRDVKPVHIVESYTLKDFAIKPQSKRIIYFND
TTQVFMSTFLDGSASHPVVPQFPFADVQSFACENNDFLVTDGKAIFQQDSMSFNEFIVGC
DLTHIEEFGFGNLVIFGSSTQPYPVPRCPRDVSVLFGSHQALVQWKPPALPIGASTSAWQ
NWTYEVQISTQDLPEFAQTFSNIKGVMLDIPGLHSAMKYKVSVRASSPKGPGPWSEPSVG
TTLMPVATEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSEDMDWYNNSLYYSDTRG
EVHVWLLNGSGVSESHRISSIAGAGALTFEWLGRFLYWAGKTYVIHRLSMLTGHSDMVTH
VKLLVNDMAVDSVGGFLYWTTLCSVESTRLNGESALVLQAQPWFSGKKVIALTLDLSDGL
LYWLVQDSQCIHLYTAGLRGQSSGAISITEFAAWSTSEISQNALMYYSGRLFWINGFSVI
TAQEIEQRTSVSVSEPARFNQFTIIQTSLKPLPGNFSSTPKVIPDSVPESSFRTEGNASA
FQVLWSAPPAVDWGVVFYSVEFSAHSKSLASEKQLLPVFTVEGLEPYTLFNLSVTPYTYW
GKGPRTSVSLRAPDTVPSTPGNPRIFVLPSERSLTKDEVIVEFRWDKPKHENGVLTRSEI
FYHISNHSDAGRASKGWIAVNVSSSVTSFQLKAMSPGYTVAFQVRVYASKGPGPLSDIVK
SQTSEINPYPYLMSFLHNEIVLLDMDQNQVVWTFLAKGDISALGYIADDGMGYFAQGDSL
FLLNLRNHSGSKLFQDAHISGITLLTVNWISRHLYFVRKESQNGTQIFDVDLEHKVKRPS
ELKICNRNSTIISLSVYPLLSRLYWTENSNLGCQMFYYSISNHTLHHILQPTATNQQSGR
VQCSCNVTEFDLSGTMTIDTCDLEKPWIYFAKRQEIWAMDLDGCQCWRVIKVPAVHAGEA
LVSLTVDKEFIYWIITAKDSSQIYQAKKRSGAAVSRVRAPQSQRVLTYSCVVQPFPDKAF
LFLASNIAEPAILNATNTSLTIALPPAKTNRTWKGLAGPTATYLVYYAALDDGTNSSYLE
YKILESQERIALIEGLQPFSTYIIKMAVKNYYSDSREHLPLGEAIWGKTKSGVPGAVWFI
NTTVLSDARLLVSWRGSHQPNGPAELVRYQLAISNLPLIPKAPLRQSQFPNARFAVLLAT
LSGGQLYVLKKVLACHPEELWCAESLPVSVKMFDTPEKPYALAPENTSLRLDWKAPSHGN
LSRFWFELQKWKYNEFFHVKASCSQGPAYTCSISGLQPYTSYRVRVVVIYMTGEKSLSPP
ESFQTKAGVPSKPGIPKLLEGSKNSIQWEKAEDNGSGLIYYILETRKITSGDSQNQNLRW
KMAFNGSCSSICMWKSKNLKGTFQFRVVAVNHLGFGDYSGVSENIILAGDDLRIPETSFI
LTIIVGVFLVITIPLAFVWHKGLKNQKTSEEGLTVLIGEDKELAELRGPVAGVGLANACY
AIHTLPTQEEIENLPAFPREKLTLRVLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLK
KGSTDQEKIEFLKEAHLMSKFDHPNILKQLGVCLLNEPQYLILELMEGGDLLTYLRKARM
TTFHGPLLTLADLVDLCVDVSKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPSRVVKIGD
FGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILVWEILTLGHQPY
PAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMAQCWAQEPIQRPTFHEIQDQLQLFRKFP
LNTISQCRGEVNTTEVINKGFEDDDDSTIRLNSDDATPVAFMVTRNQEGLNYMVLATELS
PSRDNSEGPLCFKDPKSCALRKGEKELQADQDFCQEEQVAGCLPGASPGLNYACLTHGGS
GERSD
Download sequence
Identical sequences ENSCPOP00000011703 10141.ENSCPOP00000011703 ENSCPOP00000011703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]