SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011733 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011733
Domain Number 1 Region: 821-899
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily Immunoglobulin 4.67e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 217-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000549
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 273-320
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000263
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011733   Gene: ENSCPOG00000013033   Transcript: ENSCPOT00000013159
Sequence length 924
Comment pep:known scaffold:cavPor3:scaffold_117:3614484:3843842:-1 gene:ENSCPOG00000013033 transcript:ENSCPOT00000013159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTDSGEVLPESVPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQ
NEHVSEESLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRI
AYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADH
NLIIRQARLSDSGNYTCTAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQK
RSRTCTNPAPLNGGAFCEGMSVQKITCTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTA
PPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAA
VVAVAVLVIGVTLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNPAMQPDLT
VSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERAEYHGKNHSGT
FPHGNNRGFSTVHPRNKMPYIQNLSSFPTRTELRTTGVFGHLGGRLVMPNTGVSLLIPHG
AIPEENSWEIYMSINQGEPSLQSEGSEVLLSPEVTCGPPEMIVTTPFALTIPHCADVSSE
HWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVK
QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFS
LQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNRQPLHCAFSLERYTPTTTQLSCKICIR
QLKGHEQILQVQTSILESERETITFFAQEDSAFPAQTGPKAFKIPYSIRQRICATFDTPN
AKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGRTH
TKLSNITESQLDEADFNYSRQNGL
Download sequence
Identical sequences ENSCPOP00000011733 ENSCPOP00000011733 10141.ENSCPOP00000011733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]