SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011768 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011768
Domain Number 1 Region: 285-415
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-44
Family Regulator of G-protein signaling, RGS 0.000000151
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.73e-28
Family DEP domain 0.0086
Further Details:      
 
Domain Number 3 Region: 220-276
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000034
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011768   Gene: ENSCPOG00000013069   Transcript: ENSCPOT00000013196
Sequence length 677
Comment pep:known scaffold:cavPor3:scaffold_71:1665756:1724014:1 gene:ENSCPOG00000013069 transcript:ENSCPOT00000013196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVKMQNQRVLVTSVPHAMTGVDVLQWII
QRLWISNLEAQNLGNFIVKYGYIYPLQDPKNLVLKPDSSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYNFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYAL
DCQEKAYWLVHRCPPGMNNVLDYGLDRVTDPNEVKKQTIPAVRKEIMYYQQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNF
SELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGAR
RWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIEP
QETTKRSTSLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQTGQHMAPSPHLAVY
TGTCVPPSPSGPFSPSCRSPRRPFASPSRFIRRPSSTICPSPIQVALESSSGSEPKGEVS
WSSVHRGPLATEGSEASTICSGACGQPRATTKTRAALSFSRFLRRGCLASPVFARLSPKC
PAVSHGKVQPLGDVGQQLPRLKPKRVTNFFQIKMDVPTDIGPFLMDSDDTGTGESGDRDT
EKEVICPWESLASGKAG
Download sequence
Identical sequences 10141.ENSCPOP00000011768 XP_003465288.1.53824 ENSCPOP00000011768 ENSCPOP00000011768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]