SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011800 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011800
Domain Number 1 Region: 371-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0017
Further Details:      
 
Domain Number 2 Region: 305-378
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.75e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.015
Further Details:      
 
Domain Number 3 Region: 5-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000577
Family Domains B1 and B5 of PheRS-beta, PheT 0.0098
Further Details:      
 
Domain Number 4 Region: 220-281
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000259
Family B3/B4 domain of PheRS, PheT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011800   Gene: ENSCPOG00000013109   Transcript: ENSCPOT00000013236
Sequence length 589
Comment pep:known scaffold:cavPor3:scaffold_89:2777125:2835136:1 gene:ENSCPOG00000013109 transcript:ENSCPOT00000013236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRDLLFRALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNLKAEGASNV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPNAEIQKLIVTEETAKVRPF
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDSLSGPFTYTAKRPSD
IKFKPLNKTKEYTACELMNIYKSDNHLKHYLHIIENKSLYPVIYDSNGVVLSMPPIINGN
HSKITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEATEVVFPNGKSNTFP
DLAYRKEMVRADLINKKVGIRETPENLAKLLTRMCLKSEVIGDGNQIEVEIPPTRADIIH
ACDIVEDAAIAYGYNNIQMILPKTYTIANQFPLNKLTELLRHDLAAAGFTEALTFALCSK
EDIADKLGLDISATNAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VIKDSSKDVGAKNCRRLCAIYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIRASDG
PPFFPGRCAEIFARHQSIGKLGVLHPDVITKFELTMPCSSLEINIEPFL
Download sequence
Identical sequences H0VMZ4
ENSCPOP00000011800 XP_003464035.1.53824 ENSCPOP00000011800 10141.ENSCPOP00000011800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]