SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011908 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011908
Domain Number 1 Region: 225-542
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.77e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000501
Further Details:      
 
Domain Number 2 Region: 93-212
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.29e-23
Family Anticodon-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011908   Gene: ENSCPOG00000013227   Transcript: ENSCPOT00000013355
Sequence length 548
Comment pep:known scaffold:cavPor3:scaffold_14:7885629:7901229:1 gene:ENSCPOG00000013227 transcript:ENSCPOT00000013355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKTAELYVSDREGDDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDVISK
SQMKNIKKLWHREQMKTESQEKREAEDSLRREKNLEEAKKISIKKDPSLPEPKCVKIGAL
EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCLCYNGVVLSTESSVA
VYGTLNLIPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGE
NMSKILRARSMITACFREHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAFLTQSS
QLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDLVCD
VVDRVLKSPAGSIVSDLNPNFKPPKRPFKRMNYTDAIAWLKEHNVKKEDGTFYEFGEDIP
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRIW
DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRYHIRDVCLYP
RFVQRCKP
Download sequence
Identical sequences 10141.ENSCPOP00000011908 ENSCPOP00000011908 ENSCPOP00000011908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]