SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011939 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011939
Domain Number 1 Region: 189-514
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-78
Family Protein kinases, catalytic subunit 0.00000124
Further Details:      
 
Domain Number 2 Region: 34-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-27
Family Regulator of G-protein signaling, RGS 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011939   Gene: ENSCPOG00000013262   Transcript: ENSCPOT00000013390
Sequence length 551
Comment pep:known scaffold:cavPor3:scaffold_8:38635725:38667879:1 gene:ENSCPOG00000013262 transcript:ENSCPOT00000013390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDMGGLDNLIANTAYLQARKLSDADSRELRRWRRSLALPEPQDCAELRRALAPSFDSLC
EQQPIGRRLFHDFLASVPAYQEVSTFLEEVQVWELAEQGPTKDLALQGLLATCVPAAGHP
HAFLSPGLVSRCQAAATEEERAAVVALAKGEAVGFLQDQPFRDFLASPFYDRFLQWKLFE
MQPISEKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALLEKEI
LEKVNSPFIVSLAYAFESKSHLCLVMSLMNGGDLKFHIYSIGTRGLAMSRVLFYSAQMAC
GLLHLHGLGIVYRDMKPENVLLDDLGNCRLSDMGLAVRIQDNKPVTQRAGTNGYMAPEIL
VDKVSYSYPADWFALGCSIYEMVAGRTPFKDYKEKVSKEDVKKRTLNEEALFQHENFTEE
AKDICRLFLAKKPEQRLGSRKDSDDPRKHPFFKTINFPRLEAGLIEPPFVPDPSVVYAKD
IDDIEDFSEVRGVEFDDKDDKFFKRFATGAVPIAWQEEILESGLFEELNDPNRPAGYRKG
HSSKSGVCVLL
Download sequence
Identical sequences ENSCPOP00000011939 10141.ENSCPOP00000011939 ENSCPOP00000011939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]