SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012149 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012149
Domain Number 1 Region: 190-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-82
Family Protein kinases, catalytic subunit 0.00000158
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.28e-32
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012149   Gene: ENSCPOG00000013493   Transcript: ENSCPOT00000013627
Sequence length 564
Comment pep:known scaffold:cavPor3:scaffold_5:14206081:14215271:-1 gene:ENSCPOG00000013493 transcript:ENSCPOT00000013627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGALETVVANSAFIAARGSFDGSSIPSSRDKKYLAKLRLPPLSKCEGLRESLSLEFDS
ICLEQPIGKRLFQQFLGTDKRHAPALGLWRDIEDYDTADDDLRPQKAQALLAEYLDPQAS
LFCSFLDEGTVAQVKKGQAGSQDGLFQPLLQATLAHLSQGPFQEFLGGLHFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVWACQMKATGKMYACKKLNKKRLKKRKGYQGAMVEKK
ILAKVHSQFIVSLAYAFETKTDLCLVMTIMNGGDLRYHIYNVDEENPGFSEPRAVFYTAQ
IISGLEHLHQRRIVYRDLKPENVLLDNDGNVRLSDLGLAVELQEGQNKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENQELKQRILLEPVKYPDTFS
QASKDFCEALLEKDPARRLGFQDGSCDGLRTHALFGSISWRQLEAGMLIPPFIPDSRTVY
AKNIEDVGAFSTVKGVIFDKADIEFFQEFASGNCPIPWQEEMIETGIFGELNVWRPDGEM
PDDMKGVTREQAGPTSKSGMCVVS
Download sequence
Identical sequences H0VNV0
XP_003477608.1.53824 ENSCPOP00000012149 10141.ENSCPOP00000012149 ENSCPOP00000012149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]