SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012290 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012290
Domain Number 1 Region: 4-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-62
Family G proteins 0.000000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012290   Gene: ENSCPOG00000013649   Transcript: ENSCPOT00000013787
Sequence length 207
Comment pep:known scaffold:cavPor3:scaffold_86:6845364:6855725:-1 gene:ENSCPOG00000013649 transcript:ENSCPOT00000013787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMVLG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSSQGVKITPDPQKRSSFFRCILL
Download sequence
Identical sequences A0A286Y274
10141.ENSCPOP00000012290 XP_003464305.1.53824 ENSCPOP00000012290 ENSCPOP00000012290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]