SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012308 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012308
Domain Number 1 Region: 1135-1233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.1e-28
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012308   Gene: ENSCPOG00000013669   Transcript: ENSCPOT00000013807
Sequence length 1638
Comment pep:novel scaffold:cavPor3:scaffold_42:6280032:6296963:1 gene:ENSCPOG00000013669 transcript:ENSCPOT00000013807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWTRRNRRICSKAHSWQP
GIQNPYRGTVVWMVPENVDISVTLYRDPHVDHYEAKEWTFIIESESKGQRKVLASAEVDL
ARHAGPVPAQVPLRLRLKPKSVKVVQAELSLTLSGVLLREGRATDDDMQSLASLMSVKPS
DVGNLEDFAESDEDEANGSGVPEAGARGSQPDPSQELKTLCEEDEGQVHPRQADASPTKT
EDSSSTPVSGPVPPARASRSQGSEPAIIAGGQVGPPGTPAEARSSRQPSQDMAPTPAPRL
RKGSDAPQSPVLQEGNEVPNAIASEAPPAGVGSPGETQTGTSPQEGTEAQGARPSLDTAH
MDSKDTLGGLRPKAEERATGDRSEVGGADSERGAGGELRTKRSGRTAEKTQGSPARSGFE
TEQGQVVSPVADTGPEAAGLMPEARFRVTPEAPPRGSQGKMGVRVQEETPTGLSSFPGEP
AGYSGYLGDQRGARDAAGQKRKDVEIRDIASGVERTGLEQGPSAGSASTRPQVSRFQGLP
SSAELGARPKDLKIWEAEAEESRVLEAEAGQVEWEVLGNQETEAGGSGFSEIETRPADTE
ILGVQGTETARSEVLESEAAGPEELEVLGAQETGAPGMVGKESEIAGSEVLGTQKIETGG
SAVLRTKTGVEEPEILGVEEKEVGDSEEPEMEGGETKAEILETQDTAAEGSGVPGLEAEM
AESEILGAQETEVGVSGMPGTENGMAESEVLEIKRVDGEDLKVLGTKTGMLESEIRGTPG
VSEGSTVLKIEAEIVEAQSIEVGGSRVPDPRIEEEEADMLETEEIATKCSGVLGIEALVS
ESETLGSHKRKVGVLGTPGVEIGTTEAEESETLETEVETSEVSVMEAEIAESEILGTQEI
VGGLGVPGIEAEKAELEKSEPQKAKMETRMAQTEMLRPQDIAAKSSEGSGPEAEVVWTQR
AETTVLEAEEVKVETLGVQKAEAGVEGSLNDEALKVPITKQRVLRFQEVEAEVPGIHGAE
TKALRVQGAEDRTLGVSEAKSRVLGIQKSEIAVLESTETKSGIFEAQETEAGVLGTEKGK
EAKGGIPEAGLTEAQVASGAGAGVPRPSGASSPEEPEEDRRLPGSQAPPALVNSSQSLLE
WCQEVTTGYRGVRITNFTTSWRNGLAFCAILHRFYPDKIDYASLDPLNIKQNNKQAFDAF
AALGVSRLLEPADMVLLSVPDKLIVMTYLCQIRAFCTGQELQLVQLKGGDGSGTYRVGSA
TPSLPDGLDAGNLAQRLRERGAEAPKQPKEAASRAEDSITEAAGSDAGCAPKDSDYADKA
VRKASPPGVPAADVPAAPVPPAEGLVNGAGETAGTGGVRLRQPSVSGEAGPVPPPRAHGS
FSHVRDADLLKKRRSRLRNSNSFSVDEPDAGAAGSTATAVPGAPEFLNSALAQRPDPQDC
GTLAWSLPAGGSPTLEEPPSSPAEEVGLQRFQDTSQYVCAELQALEQEQRQIDRRAAEVE
TQLRSLMESGTNRLQEEVLIQEWFTLVNKKNALIRRQDQLQLLIEEQDLERKFELLSREL
RAMLAIEDWQKTATQQHREQLLLEELVSLVNQRDELVRDLDQKERIALEEDERLARGLEQ
RRRKLSRQLSRRERCVLS
Download sequence
Identical sequences 10141.ENSCPOP00000012308 ENSCPOP00000012308 ENSCPOP00000012308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]