SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012329 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012329
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-90
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 2210-2330
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-34
Family Pleckstrin-homology domain (PH domain) 0.00000369
Further Details:      
 
Domain Number 3 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 4 Region: 907-1062
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-31
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-27
Family Spectrin repeat 0.0000377
Further Details:      
 
Domain Number 6 Region: 1645-1798
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-27
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 697-817
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-25
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 1856-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 1226-1380
Classification Level Classification E-value
Superfamily Spectrin repeat 4.61e-22
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 10 Region: 532-640
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-21
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 11 Region: 1483-1595
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 1382-1494
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-20
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 13 Region: 429-527
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-19
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 14 Region: 2016-2076
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000187
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012329   Gene: ENSCPOG00000013691   Transcript: ENSCPOT00000013830
Sequence length 2387
Comment pep:known scaffold:cavPor3:scaffold_42:7250253:7281922:-1 gene:ENSCPOG00000013691 transcript:ENSCPOT00000013830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGEMLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAERYHDIKRISARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDL
LYLMDWMGEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDP
GTEYRPCDPQLVSERVANLERSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQ
QHLLASAETGRDLTGVLRLLNKHTALRDEMSGRLGPLRLTLEQGQQLVAEGHPGASQASA
RAAELQAQWERLEALAEERTQQLTQAVSLHQFQAEANDMEAWLVDALRLVSSPELGHDEF
STQALARQHRALEEEIRGHRPTLDALREQAAALPSALSHTPEVQGRVPTLERHYEELQAR
AGERAQALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPE
MNALAARITAVNDIAEQLLKANPPGKDRIINTQKQLNQRWQQFRSLADGKKAALTSALSI
QNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTR
EANTLATSHPAQAPAINARLGEVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAW
LGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAKSEYSRLRALGEEVTRDQADPQC
LFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEM
PGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSEGNIHAEKIQEKADSIERRH
RKNQEAVQQLLGRLRDNREQQHFLQDSHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQ
AFMAELAANKDWWNSVHHHEGRELSLEKPDLKALVSEKLADLHHRWDELETTTQAKARSL
FDANRAELFAQSCSALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEV
EAIQAQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMKERCQRLQASREQHQFHRDVAD
EILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIEDLTERQRALGAAAA
GPELAELQGMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKD
ELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDLIDHDHPESTRLSIRQAQVDKLYASL
KELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREF
SRDTSTIGQERVDSANTLANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAA
AYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSAQVQQV
QDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVREL
MLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADCFSSCIDMGQELLARNHY
AAEEISEKLSQLQARRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSA
ELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEEREKERKRKREEEERRKQPP
APEPTAGLPAGELVDGQAGWDGSQPRQPASSQAPSVNGVCTDSESSQPLLEQQRLEQSSF
SEGPGTGAGDEANGPRGERQTRPQGPASPVMPQSRSSESAHVAALSGRGPELSAQEQMEG
MLCRKQEMETTLKKAANRSWQNVYCVLRNGTLGFYKDAKAASVGVPYHGEVPVRLTRAQS
GVAFDYRKRKHVFKLSLQDGKEYLFQAKDEAEMSSWLRVVNAGIASASSDSGELGEPAIP
SGTRGMTRAMTMPPVSQAGTEGSVVLRGKDGRERDREKRFSFFKKNK
Download sequence
Identical sequences ENSCPOP00000012329 10141.ENSCPOP00000012329 ENSCPOP00000012329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]