SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012587 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012587
Domain Number 1 Region: 15-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-32
Family Spectrin repeat 0.0000005
Further Details:      
 
Domain Number 4 Region: 391-505
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-24
Family Spectrin repeat 0.000000534
Further Details:      
 
Domain Number 5 Region: 634-746
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-22
Family Spectrin repeat 0.000000573
Further Details:      
 
Domain Number 6 Region: 739-867
Classification Level Classification E-value
Superfamily EF-hand 4.16e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012587   Gene: ENSCPOG00000013969   Transcript: ENSCPOT00000014110
Sequence length 894
Comment pep:known scaffold:cavPor3:scaffold_16:5484889:5557403:1 gene:ENSCPOG00000013969 transcript:ENSCPOT00000014110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERVEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIAAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHTNERLRRQFAAQANAVGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences H0VPZ1
ENSCPOP00000012587 ENSCPOP00000012587 XP_005005298.1.53824 10141.ENSCPOP00000012587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]