SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012849 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012849
Domain Number 1 Region: 436-639
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.21e-59
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 219-335
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-28
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 130-233
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-19
Family PDZ domain 0.0017
Further Details:      
 
Domain Number 4 Region: 87-136
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000112
Family L27 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012849   Gene: ENSCPOG00000014262   Transcript: ENSCPOT00000014404
Sequence length 648
Comment pep:known scaffold:cavPor3:scaffold_104:352977:389075:1 gene:ENSCPOG00000014262 transcript:ENSCPOT00000014404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQSDTGADPPDKEDKKFSTVDNPENGLSRILRLLLQELSLFYSRDLSGLCLLYDLLHSP
WLQALLKVYDRLQQFREKKPAPTTHCAQQLSREVVELLRESSNSLEIQELRQILQAPHYE
ALLRAHDTVAQKDFEPLLPPLPDSLPENEEATRIVCLVKNQQPLGATIKRHEMTGDILVA
RVIHGGLVERSGLLYAGDKLVEVNGVSVEGLQPEQVIHILAMSRGTIMFKVVPVSDPPVN
NQKTVHVRAMIDFWPQEDPAIPCADAGLPFQRGDILQIVDQNDALWWQARKVSDPVTCAG
LIPSNHLLKRKQREFWWSRPYQPHTCLKPSISISMEEDDYMKIDEKCVEAGKTTDEETFE
SAFDARPEELSEDKEEFVGYGQKFFLAGFRRSLRLCRRKSHLSQLRATLCGTGTGGGCWT
VGAPYEEVARYQRHPADRHRLVVLVGPSGVGVNELRRQLIECNPSRFQSAVPHTTRSPKS
YEMNGREYHYVSKETFESLIYSHRMLECGEYRGHLYGTSVDAVCTVLDEGKICVLDLEPQ
DIQVARTSELKPYVIFIKPSNMSCMKQSRKNAKIITDYFVDMKLQDEDLQEMEELAQKIE
TQFGQFFDHVIVNDNLQDACAQLLSAIQQAQEEPQWVPATWISSDTEA
Download sequence
Identical sequences ENSCPOP00000012849 10141.ENSCPOP00000012849 ENSCPOP00000012849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]