SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012936 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012936
Domain Number 1 Region: 678-945
Classification Level Classification E-value
Superfamily RNI-like 1.28e-48
Family 28-residue LRR 0.0027
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily DEATH domain 4.62e-18
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012936
Domain Number - Region: 193-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000957
Family G proteins 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012936   Gene: ENSCPOG00000014360   Transcript: ENSCPOT00000014504
Sequence length 953
Comment pep:novel scaffold:cavPor3:scaffold_44:6769039:6790109:-1 gene:ENSCPOG00000014360 transcript:ENSCPOT00000014504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQGHREMEGGLSESHSHVRLLKVNRELLVTHIRNVQCLVDNLLHNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYVLQQLADAYVDLRPWLLEISFSPSQLIQNKTI
VNTDPVSRYTQKLRHQLGCDSKFMLCYAQKEELLLEETYTDTIMELVSFSNEILGSLSSL
ACLLDPSSDVLNEHGETVFVFGDAGVGKSMLLQRLQSLWASGRLGAEIKFFFHFRCRIFS
CFKDSDTLSLQDLLFKHFCYPEQDPEEVFAFLLRFPQAALFTFDGLDELHSDFDLSRVPD
TCCPREPAHPLVLLANLLSGRLLQGARKLLTARTGVEVPRHLLRKKVLLRGFSPIHLRAY
ARRMFPERAAQAHLLQQLEANPNLCSLCAVPLFCWIIFRCFQYFHSAFEGSPQRPDCAVT
LTDVFLLVTEVHLNRTQPRSLVQRNTRSTAETFRAGLRTLRALGQVARSGMEQSLFVFCQ
DDVEASGLQEADLALGFLRTTPALGPCGGQSYEFFHITLQAFFTAFFLVVDDKVGTQELL
RFFREWTPPGEGAAASCLPSLLPFQRWRGGRPAGSDLFKNKDHFQFTNLFLCGLLSKARQ
ELLRHLVPAAALRRKRHALWTHLCTSMRSYLKSLPRLHSGGFKQVQAMPTFLWMLRCIYE
TQSQKVARLAARGVCADYLKLTFCNACSADCSALSYVLHHLHKSLALDLDNNNLNDYGVR
ELQPCLSRLVVLRLSVNQITDNGVKVLCEELTKYKILTYLGLYSNQITDVGARYVAQILE
ECKGLTHLKLGKNKITSEGGKCLALAVKNSTWISDIGMWGNQIGDEGAKAFAEALRDHPR
LSFLSLAFNCISTEGGKSLAQALQHNTSLLTFCCIINSLQNSEKAESFASILYWTQLYSS
FRLIQNQITAKGTAQLAEALRENTGITEICLNGNLIKPEEAKAFEEEKRLICF
Download sequence
Identical sequences 10141.ENSCPOP00000012936 ENSCPOP00000012936 ENSCPOP00000012936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]