SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013104 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013104
Domain Number 1 Region: 955-1085
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-45
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 60-185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.89e-22
Family Synaptotagmin-like (S variant) 0.00082
Further Details:      
 
Domain Number 3 Region: 216-297
Classification Level Classification E-value
Superfamily PDZ domain-like 9.85e-18
Family PDZ domain 0.0000151
Further Details:      
 
Domain Number 4 Region: 475-578
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000116
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013104   Gene: ENSCPOG00000014542   Transcript: ENSCPOT00000014687
Sequence length 1091
Comment pep:known scaffold:cavPor3:scaffold_93:5919146:6035111:1 gene:ENSCPOG00000014542 transcript:ENSCPOT00000014687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVCNTSGLSVLSTLYGLSLRLPIFSGWMEWPNKDTSLHRKDAWTQTFPARKKIRRAQVQG
VGQLKLSIDAQDRILLLHIIEGKGLMSQEPGVCDPYVKISLIPESNQIRSQKTQTIPDCR
DPAFHEHFFFPVPEEDDQKRLLLTVWNRASQTRQRALIGCMSFGVRSLLTLNKDISGWYY
LLGEDMGWTKHLKVARRRLRPLRDPLLRMPGSGDTENGERLQITIPRGEDGFGFTICCDS
PVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPGEIILLVWRMVP
QVKPGPDGGVLRRASCKSTHDLLSPPNKREKNCTHGAQARPEQRHSCHLVCDSSDGLLLG
GWERYTEVGKHGGQHTLPTLSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIPEESGSP
TKGKSYTGLGKKSRLMKTVQTVKGRGNYQDCSLLRPHVPHSSYGTYVTLAPKVLVFPVFV
QPLDLCNPARTLLLSEELLLYEGRNKASQVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQ
SVKLQEGSSGDLKFCLLYLAEKAECLFTLEAHSQEQKKRVCWCLSENITKQQQLAASLPE
RKMFETEADEKREMPLEEGKGPGAEDPPPSKDCSPEQQPPSPLGGDLPPNQDSPLGQEPA
SGQESLSNNDSPCGQEPPADSEAPPRQDSPAGQGSPPTSKLPACQDLSAGQEPTPPQDAP
VGQDLPEVAEPPGQAPLPCQDLPPSPNSLPAKAPVEETSCSGDVAAATETLAAASRPAFI
IPEVRLDSTYSHADTSDDNYGERSEAKRSSMIETGQGSEGGLSLRVQNSLRRRTHSEGSL
LQEARGPCFSSDTTLHCSDGESPSSSWAIPSPRTLKKELSRNGGSMHHLSLFFTGHRKMS
GADVVGDDDEGSQKRKSKNLAKDVKNKLAIFRRRNESPGAQPAGKTDKMIKSFKPTSEEA
LKWSESLEKLLLHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFA
EFIAIQSCKEVNLDSYTREHTRDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDIYLD
LINQKKMSPPL
Download sequence
Identical sequences 10141.ENSCPOP00000013104 ENSCPOP00000013104 ENSCPOP00000013104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]