SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013206 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013206
Domain Number 1 Region: 72-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.2e-49
Family Regulator of G-protein signaling, RGS 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013206   Gene: ENSCPOG00000014656   Transcript: ENSCPOT00000014801
Sequence length 209
Comment pep:known scaffold:cavPor3:scaffold_12:28934987:28938368:-1 gene:ENSCPOG00000014656 transcript:ENSCPOT00000014801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAAISTPRLDKMPGMFFSANPKDLKETDHPFLEDKTQKRRPRTFGMDMKAYLRFMMPH
LESGMKPSKSKDILSADEVMQWSQSLEKLLANRTGQDVFGNFLKSEFSEENIEFWLACED
YKKTESNLLHSKAEDIYKVFVHSDAAKQINIDFHTRESTAKKIKSPTPTCFDEAQKVIYN
LMEKDSYPRFLKSDIYLNLLNELQASSLK
Download sequence
Identical sequences H0VRJ1
ENSCPOP00000013206 ENSCPOP00000013206 10141.ENSCPOP00000013206 XP_003474908.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]