SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013244 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013244
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Caspase-like 9.12e-84
Family Caspase catalytic domain 0.000000000401
Further Details:      
 
Domain Number 2 Region: 32-121
Classification Level Classification E-value
Superfamily DEATH domain 1.51e-21
Family Caspase recruitment domain, CARD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013244   Gene: ENSCPOG00000014698   Transcript: ENSCPOT00000014843
Sequence length 452
Comment pep:known scaffold:cavPor3:scaffold_10:5214541:5227600:-1 gene:ENSCPOG00000014698 transcript:ENSCPOT00000014843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRAASRPPVQQKGPVAADRRRRIVGACGMHPDHQETLKRNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFNQNVELLNLLPKRGPEAFDAFCTALRETKQGHLEDLLLT
TLSDLQHVLPPLSCDYDVSLPFPVCESCSPHKQLRLSSDVVEHSLDNGDGPPCLQVKPCT
PEFYQTHHQQAYRLQSRPRGLALVLSNVHFTGEKDLELRSGGEVDYSTLVTLFKLLGYDI
HVLHDQTAQEMQEKLQSFAQLPAHRATDSCVVVLLSHGVEGSVYGVDGKLLQLQEVFRLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQLDGKDHATSPECEESDAGKEELLKMRLPT
QSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKEREGY
APGTEFHRCKEMSEYCSTLCRPLYLFPGYPPT
Download sequence
Identical sequences A0A286XN12
ENSCPOP00000013244 ENSCPOP00000013244 10141.ENSCPOP00000013244 XP_003475318.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]