SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013661 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013661
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-19
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013661   Gene: ENSCPOG00000015152   Transcript: ENSCPOT00000015299
Sequence length 541
Comment pep:known scaffold:cavPor3:scaffold_18:38975321:38982337:-1 gene:ENSCPOG00000015152 transcript:ENSCPOT00000015299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDYENEDECWSTLEGFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGLLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSTIIDASGESGLTQLLM
TEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVRRLKEECEAGMRDLKRCKD
ENYDLAMKLTRLSEEKGAALMRNRDLQLEVDRLRHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQERLWELQQEKALLQARVQELEAAAQDGKLERSSPYIQVLEEDWRQALRDHQEQAAT
IFTLRKDLRQAEALRTRCSEEREMIELQCLALRKDSKMYKERIEAILQQMEEVAIERDQA
MALQEKLHTQCARSLQEKDELRKRIRELGEKADELQLQLFQSEGQLLAAEAQLKQQQQLD
TLVLLGTQSSDLEDSSPRNSQELSLLGDLEDDGQLPDKGGLAENLEQLCVSLQKEPCSLS
PHDLGPSVGGEPPEKERRRLKESFENYRRKRALRKVHSGWQQGEGDRGNSSGSDNTDTEG
S
Download sequence
Identical sequences 10141.ENSCPOP00000013661 ENSCPOP00000013661 ENSCPOP00000013661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]