SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013698 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013698
Domain Number 1 Region: 610-911
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.53e-73
Family WD40-repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 961-1238
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-55
Family WD40-repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 107-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-44
Family RecA protein-like (ATPase-domain) 0.073
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 1.55e-21
Family Caspase recruitment domain, CARD 0.00000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013698   Gene: ENSCPOG00000015196   Transcript: ENSCPOT00000015343
Sequence length 1249
Comment pep:known scaffold:cavPor3:scaffold_9:3488038:3550904:-1 gene:ENSCPOG00000015196 transcript:ENSCPOT00000015343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGVLTISEEERVKNQPSNHQRAATLIKMI
LNKDNPSYISFYNALLREGYKDLAALLHSGMPVFSSSSGKDSASGITSYVTTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLRKLSGEPGWVSIYGMAGCGKSVLAAEAVRDHSLLESCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDQSFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKHVVPVESGLGKEKGLEILSLFVN
MKKTDLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFYYYLHDLQVDFLTEKNRSQLQDLHKKMITQFQRYHQLHTLSPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTQLVGPAHLIHEFVEYRHILDEKDGAV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLQAKQEVDSGMLYLEWINK
KTIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEVKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSVTGKLVHIYDEHTEQVNCCCFTNSSQNLLLATAS
NDCLLKLWDLNQNYCRNTLINHLNSVTHCRFSPDDELLASCSADGTLKLWDVRSANESKS
INVKQFFLNPEEPHEDLEVIVKCCSWSADGARVMAAAKNKIFLFDIHTSGLVAEIHTGHH
STIQYCDFSPHNQLAVVALSQFCVELWNTDTCVKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRVWETKKVCKNSAVVLKQEIDVVFQDNEVTVLAVDNMRRLQLIKGKTGQTDYLT
EAQVSCCCLSPRLQYVAVGDEDGAIEILELLNNKVFQSRIGHGKAVRHMQFTADGKTLIS
SSDDSVIQVWSWQSEECVLLQAHQETVTDFRLLENSTLLSWSFDGTVKVWDIVTGRIEKD
FVCHQATVLSCDISSDATKFSSTSADKTAKIWSFELASPLHELRGHSGCVRCSTFSEDGS
LLATGDDNGEVRIWSASKGELLHLCAPSSVEDGAATHGGWVTDLRFSPDSSALVSAGGHL
KWWDVTTGESAQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQILE
Download sequence
Identical sequences A0A286XWJ4
ENSCPOP00000013698 10141.ENSCPOP00000013698 XP_013014818.1.53824 XP_013014819.1.53824 XP_013014820.1.53824 XP_013014821.1.53824 ENSCPOP00000013698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]