SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013782 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013782
Domain Number 1 Region: 550-980
Classification Level Classification E-value
Superfamily RNI-like 2.96e-75
Family 28-residue LRR 0.0000155
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-30
Family Pyrin domain, PYD 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013782
Domain Number - Region: 144-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00209
Family G proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013782   Gene: ENSCPOG00000015292   Transcript: ENSCPOT00000015441
Sequence length 986
Comment pep:known scaffold:cavPor3:scaffold_175:254588:273499:1 gene:ENSCPOG00000015292 transcript:ENSCPOT00000015441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPFFADFGLMWYLQELKKKEFMRFKELFKQETSQLGLRQIPWAEVKRASREELASLLL
EHYEEQQAWDVTFRVFQRMDRQDLCERATRESTGHSKMYQAHVREKFCSILVKEAIPAIH
KSYDENIIQDELQYVESLFTPKTPGKVVHTVLLRGKQGSGKTHLLTKLMLAWSRGHLYLD
RFFYIFYFCCQELKHLPVTSLAELISSTWPDASAPVSQILAHPEKILFLVDGLEQLGCDL
SEPESELCQGWGEARPPRLLLSSLLKRKMVPECCLLITVTMEFGLELEARLADPEVRMLM
GFGNRDIQECLYRVFQDLQQATEAFCIIQQNAQILELCRLPVPCWLVSTVLKLEMDRGAD
MAHACSRSTPLYASFLFHLFTPRMPEGPSWQGQAQLHSLCSLAVQGMWANCMVFGEQDLR
RNGIADSDLPALLELRILLRCRGPEPRYKFLHSSIQEFCAALFYLLKSPGHHPHPAVAGT
QDLLLTFLDKSRTHWVFLGCFLFGLLHERERQRLDTFFGFQLSNEVKQQLYQCLKVLGQT
KDLHKKVHLLALFYCLFEMQDEAFVRQAMALLQELTFPISSRTDLEVSAHCLKHCSNLRQ
LSLSMKLVLTRGEKGQGSESDSDLLHWYQVCSVLTTNGHLHTLRVKDSTLSEPAFAVLFN
QLSQPNCILENLLHANVNFHCESWRLFEVLMHNPNLKHLNLSNTRVGHEDVKWLRDMLNH
PTCHVNKLVLVNCKLKADECRVFASILMDNRKIRYLNLASNHLGKGVRALCKALCHPDST
LNLLGLAFCSLSNWCWDYLAEVLLTNRTLKVLDLSLNIMRDEGLNVLCEALRFPSCSLEV
LCLMQCSITEEGCRDLAAALTTNGNLRNLQLSGNLLKDTGVKLLCGALAQPSCHMEYLGL
EDCGLTGACCGDLATVLTSSRTLILLNLIDNRLGHHGVVLLCEGLRHPDCNLHLLGLRRT
MFRPETQALLLDEEERNPNLIITDDW
Download sequence
Identical sequences ENSCPOP00000013782 ENSCPOP00000013782 10141.ENSCPOP00000013782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]