SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013807 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013807
Domain Number 1 Region: 25-101
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000118
Family DEATH effector domain, DED 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013807   Gene: ENSCPOG00000015321   Transcript: ENSCPOT00000015470
Sequence length 318
Comment pep:known scaffold:cavPor3:scaffold_56:10920401:10922535:-1 gene:ENSCPOG00000015321 transcript:ENSCPOT00000015470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLKRRAGQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEE
TSIRYVTPRTLSDPEPRPPQPPKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHDTALQGNVFSNKQDPLERQFERFSQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
Download sequence
Identical sequences A0A286XDA3
XP_003466629.1.53824 XP_013004679.1.53824 XP_013004680.1.53824 XP_013004681.1.53824 ENSCPOP00000013807 10141.ENSCPOP00000013807 ENSCPOP00000013807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]