SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013823 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013823
Domain Number 1 Region: 47-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.55e-47
Family Regulator of G-protein signaling, RGS 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013823   Gene: ENSCPOG00000015337   Transcript: ENSCPOT00000015486
Sequence length 205
Comment pep:known scaffold:cavPor3:scaffold_39:563836:568440:1 gene:ENSCPOG00000015337 transcript:ENSCPOT00000015486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAGLPASCLKSAKDMKHRLGFLLQKSDSCEHNSSHSKKDKVVICQRVSQEEVKKWG
ESLENLISHECGLAAFKAFLRSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQRKIFHLMEKDSYRRFLKSPFYLDLTNP
SSCGAEKQKGAKSSANCTSRLPQCA
Download sequence
Identical sequences A0A286XMW3
ENSCPOP00000013823 XP_003468662.3.53824 ENSCPOP00000013823 10141.ENSCPOP00000013823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]