SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013841 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013841
Domain Number 1 Region: 3-239
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.62e-76
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 259-381
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-29
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 1404-1543
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-26
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 4 Region: 1287-1441
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-20
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 655-791
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-20
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 1605-1759
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 1828-1973
Classification Level Classification E-value
Superfamily Spectrin repeat 4.13e-19
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 8 Region: 968-1120
Classification Level Classification E-value
Superfamily Spectrin repeat 3.98e-18
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 1073-1223
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-18
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 552-702
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-18
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 11 Region: 821-914
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 12 Region: 382-493
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000552
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 13 Region: 1979-2035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000892
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 14 Region: 1204-1299
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000041
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013841   Gene: ENSCPOG00000015356   Transcript: ENSCPOT00000015505
Sequence length 2036
Comment pep:novel scaffold:cavPor3:scaffold_10:27429755:27466256:-1 gene:ENSCPOG00000015356 transcript:ENSCPOT00000015505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YELGHVRRLQAQHTHMQEKTFTKWVNNIFRLSQVGIKIQNLYTELADGTHLLRLLELISG
EALPAPSRGRLRVHFLENNSRALAFLRAKEVPIPLIGPENIVDGDQTLILGLLWVIILRF
QISHISLDRTEGRQAQLSAKEALLVWCQRKTASYTNVAITDFSHSWRDGLGFNALIHAHR
PDLLDYSSLHPSRPLHNLTCAFHVAEQELGIAQLLDPEDVAALHPDERSIMTYVSLYYHF
FSRLQQGQTVKRRLAKILLQLQETEALRTQYEQLMADLLRWIAEKQLQLEERNFPDSLPD
MCQLLAAFASFRAQEKPPRLQQRGATEALLFRLQMVLRTQNRRPFVPVEGLSLVELSQCW
AALERAEAARSQALQQRLLRLERLETLTRRFERKAALRENFLKDAELELNQARIPPASPA
TVEAASQRLGMLEASILPQEGRFQALVEIADILQQEQYHSWADVAHRQREITGRWQKLLQ
HLQEQRKQIAGVQAVLNLLQEVEVTAERLRELQVPASSTNCGRQLEEVVELLQRHNLLEA
QVSAHEAHVSHLANQTAELDPSVGMSVEMLQAKARVLVQLHQRLVSLVRARRALLEQTLR
RAEYFEDAAEASSWLRDLRQALGSSCGGQDQASAQVLLLRHLRLERSVRAFAVELRQLDE
QARVAVAQSSLTAPQVREQLQSVQVQWTRVQERSEQRRQQLQASLQLQYFLRVSELEGWV
EEKLPLVRSQDFGRDEAATFRLIRKHQVLEQELALYWSSMEALDQRAQALAGSKAPVVQK
RLWERLQALQELAATRSLGQAEAQLRAHKALECELLGTEHQAEDWVQERVQQLRQPIPPG
DLKDNWKHLQKHQAFEAEVKALEQALISVAKQGEALLAQSHPWAGEVSQRLQALQESGEK
LRQAVAIRGQELKDKRNFLEFLQKADLTEAWIQEKEMMVNTGDLGQDLEHCLQLCRWLHK
FQGTKLPLQSLQHKVGCLCQTQPGAIHGLSHKQREMMDSWWQLQSRVQKRRESLETEHQV
QKLLVLLGDLLVWAQRLRATVDNQGTPSSLAVSWHMLEEHQACKDELDGRRDSINLARST
GQQLLAAGHPLAPSIHQALTALDQELSSLQGAWQEHQLYLQQAMELQRLLSSVEKAEREL
CSEEASLAIEGLGDPSAKMEVLLHKHQRLEQRLEAQVEKLSTLEATARSLQQGRHAEAQN
ALARCQALLLRMHSLNKTLLQRARTQGQQLEQLQTFLQDSLEVTTWLRKKNLVALEEGWR
DPATLQALLCKQRNLQAELDTSLHQQQELQQEGQRLLQGNHPASETIQEQLKELRELWAK
LQANSQRNMAQLQKACEALHLQRNLGELESWLEPMEVELRAPLGDQDLPGVGKLLRAQEE
LEAALSRQVRRAWALLDQARVLTSEQEGHCLAKDVEEQAQKLLQRFKSLQEPLQERRTAL
EARSLLLQFFRDADEEMTWVQEKLLLAAAQDFGQSLSTVQHLQEKHQNLESEISNHEALT
EAVVDTGHKLVQVGHFAAHEVAARLQQLEEALEQLRTEAARRRLLLQQAQEAQQFLTELL
EAESWLAERSHVLDREDMGQSAEATQALLRRLEATRRDLQGFSRRIEQLQQTAALLECGQ
NPDSPKVLAQLQDVRQAHEQLLRKAECREQGLWEQLQLHQLEQEVLLLDAWLNARVAVAE
SQDYGQDLQSVQVLEARFDAFRREVQSLGQAKVQALRELMNPLERRAPGVYPQIQSQKSH
IEATWERLNKAIKTRTENLAIAHELRGFEQEAAELQGWIQEKTTLLEGQLHGHSLPPVHP
FPQQDSCLQRELAAIEKEVAQVQMEAFQLGQRHPAAQEGLAELLVKVQEAWATLEEKVQE
HSQQWAQAAQGHAFLRHCWELLAWAQERQGIMSSEELARDLVGARQLLGQHKELGQEIQE
HCLKAQAIWQEGQQLLDNGHFMSPEVAQSLQELQGQLQELQAAWVLRQQRCEESQSLLEL
RQGLEQAEAWLASRESLLLQTSFGYSVLDVERLLHRHEDLETLLAAQEEKFAQLQK
Download sequence
Identical sequences ENSCPOP00000013841 10141.ENSCPOP00000013841 ENSCPOP00000013841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]