SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013914 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013914
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.29e-25
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013914   Gene: ENSCPOG00000015431   Transcript: ENSCPOT00000015582
Sequence length 2309
Comment pep:novel scaffold:cavPor3:scaffold_9:21241581:21467797:-1 gene:ENSCPOG00000015431 transcript:ENSCPOT00000015582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRNHSQMVE
ERDIVVSFLDLRGVGIQLAGYKEIRNGNLKAILGLFFSLSRYKQQQHRQQQYYQSLVELQ
QGVTHTSPPPEPSQVKTQQDMQSSLTARYATQSNHSGIATSQKKPTRLPGPSRVSAAGSS
SSKAQGASNLNRRSQSFNSIDKNKPPNYANGNEKVITVPDSSKGPAPSSGVNGNMQPPST
AGQPPASAIPSPSASKPWRSKSMNVKHSATSTMLTVKQASPATSPTPSSDRLKPPVSEGV
KPAPSGQKSMLEKFKLVNARTALRPPQSPSSGSNDGGKDDDVFSECSEMEGFNSGLNSGG
STNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKICTEKPVKEEKDQVIET
ASKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTAKQTISPSSTASKESEKFRTTK
GSPSHSLPKPIATEKTSTYCPAPLDGREAGQASLCTVSVQSSSQSTGNGAVQLPQQQQQH
SHPNTATVAPFIYSAHFCNQNCLRIPNYEKCPSLTKNSLSSQRTLKIQCSQSLGGEDPET
RRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTVTTEVNGRTIPNLTGRPTPM
TWRLGQASPRLQAGDAPSMGAGYPRSGTSRFIHTDPSRFMYTTPLRRAAVSRLGNMSQMD
MSEKASSDLDMSSEVDVGGYMSDGDILGKSLRSDDINSGYMTDGGLSLYTRSLNRVPDTT
TSRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTTSSVSSYSNITVPSRK
STQLKTDSEKRSTADDTWDSPEEVKKPEEDFDSPGDGGGKWKGSSSSGAPEDVEKAGQKG
SLAVSQTGSWRRGMSAHGGAPARQKAGTSALKTPGKTDDAKASEKGKTPLKGSSLQRSPS
DAGKSSGDEGKKPPSGIGRSTATSSFGFKKPSGVGSSTMITSSGATITSGSATLGKIPKS
AAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQYRSLPRPSKSSTSGIPGRGGHRSST
SSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDSESVSLSGSPK
SSPTSATACGTQGLRQPGSKYPDIASPTFRRLFGAKAGGKSASAPSTEGVKSSSVVPSPS
TTLARQGSLESPSSGTGSMGSAGGLSGGSSPLFNKPSDLTTDVISLSHSLASSPASVHSF
TSGGLVWAANLSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSL
LMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHSTGGLQDTGNQS
PLVSPSAMSSSTTGKYHFSNLVSPTNLSQFNLPGPTMMRSNSIPAQDSSFDLYDDSQLCG
SATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELV
ASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKA
QNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGNDADSKKKKKK
NWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSTSMK
PSHSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRL
EALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNAAKPTRPPSESASSTSSSSSR
QSLGLSLNNLNITESVTSDILLDDAGDTSGHKDGRSVKIIVSISKGYGRSKLNIHSAKYP
IGNVRLGIGIIGKTTHTLFQYVLIMVVIIYMYRVDVSTVLWRHSNCPSPISMRIMFRNHR
LGIPVIMSHTTFIKDNLVRNVSLHIFRNKCDLKPTGFLIPKKKPRHFNKDGDHNICLKSI
EAVIGRSLWKNHMAFIIKKAVNTTTDVCCFFMVVRKSSLDELQQYLANLAEQCSADNNGV
ELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRRWVL
CANHTEPVKGFLGRYLRRKLIELEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDV
TIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRAPWEDPSRWVLDT
YPWGTASLQQEGPALLELRPEDVGYEGCTSTKEATTSKHIPQTDTEGDPLMNMLMKLQEA
ANYSGTQSCDSDSTSHHEDILDSSLESTL
Download sequence
Identical sequences ENSCPOP00000013914 10141.ENSCPOP00000013914 ENSCPOP00000013914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]