SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013930 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013930
Domain Number 1 Region: 160-505
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-86
Family Protein kinases, catalytic subunit 0.00000000000301
Further Details:      
 
Domain Number 2 Region: 3-157
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-41
Family Regulator of G-protein signaling, RGS 0.0000000525
Further Details:      
 
Domain Number 3 Region: 527-637
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013930   Gene: ENSCPOG00000015449   Transcript: ENSCPOT00000015600
Sequence length 662
Comment pep:known scaffold:cavPor3:scaffold_42:7759892:7777511:1 gene:ENSCPOG00000015449 transcript:ENSCPOT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEAKPLVEFYE
EIKKYEKLETEEEREARSREIFDSYIMKELLACSHPFSKSATEHVQGHLAKRQVPPDLFQ
PYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYG
CRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKL
SFILDLMNGGDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDE
HGHVRISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRG
HSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVHRRLGCLGRGAQEV
KESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYR
NFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSK
MGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGG
KQFVLQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLIQRGSAN
GL
Download sequence
Identical sequences 10141.ENSCPOP00000013930 ENSCPOP00000013930 ENSCPOP00000013930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]