SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014035 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014035
Domain Number 1 Region: 333-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.93e-58
Family Nucleotide and nucleoside kinases 0.0000153
Further Details:      
 
Domain Number 2 Region: 193-323
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-35
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 122-212
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-17
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 4 Region: 54-108
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000001
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014035   Gene: ENSCPOG00000015565   Transcript: ENSCPOT00000015717
Sequence length 540
Comment pep:known scaffold:cavPor3:scaffold_44:1661679:1704876:1 gene:ENSCPOG00000015565 transcript:ENSCPOT00000015717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPELNNSSINN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAG
LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGT
ISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIV
LNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEGDIKAGKYLEHGEYEGNLYGTKID
SILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKL
LTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY
Download sequence
Identical sequences A0A286XMK8
XP_003467948.1.53824 XP_013005912.1.53824 XP_013005913.1.53824 ENSCPOP00000014035 10141.ENSCPOP00000014035 ENSCPOP00000014035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]