SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014124 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014124
Domain Number 1 Region: 50-103
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000863
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number 2 Region: 105-151
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000898
Family TNF receptor-like 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014124
Domain Number - Region: 147-186
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000238
Family TNF receptor-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014124   Gene: ENSCPOG00000015661   Transcript: ENSCPOT00000015816
Sequence length 418
Comment pep:known scaffold:cavPor3:scaffold_107:817446:823572:-1 gene:ENSCPOG00000015661 transcript:ENSCPOT00000015816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPRAASPSGLAWGPLLLGLYYGLLAASHPQPAPPYHSENHMCSDQEKEYYEPKHQVCC
SRCPPGTFVTAECNRSQNTVCTTCAENSYNEHWNHLPICQLCRPCDSVLGFQEVAPCTST
RKTECRCQPGMFCIHRDPECVHCEPLSECPPGTEVELKDEDRESDNTCIPCKAGHFQNTS
SSSARCQPHTRCEDQGLVEVAAGTAQSDTGCKSPPEPLPPEMPGTMLVLAILLPLVSFLL
LTTLIACTWKSHSSLCRKLAGSLLKRRPEGEESSSCPLPRPIPDLVKPLLPISGDLSPGP
ARPPGSPPLEEVVLQQQCPLVQASGADAELGEQGQVAHGANGIHVTGGSVTVTGNIYIYN
GPVLGGARGPGDPPAPPEPPYPTPEEGVHGPSQLSRPYQEDGKAWHLAETETLGCYAL
Download sequence
Identical sequences ENSCPOP00000014124 10141.ENSCPOP00000014124 ENSCPOP00000014124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]