SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014177 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014177
Domain Number 1 Region: 323-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.46e-80
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 106-218
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.0000233
Further Details:      
 
Domain Number 3 Region: 222-292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 6-60
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000126
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 5 Region: 56-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014177   Gene: ENSCPOG00000015723   Transcript: ENSCPOT00000015878
Sequence length 621
Comment pep:known scaffold:cavPor3:scaffold_7:52107427:52125525:-1 gene:ENSCPOG00000015723 transcript:ENSCPOT00000015878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVETEDQVLATFCGKETTDTEQTPGQEVVLSPGSFMSVTFRSDFSNEERFTGFDAHYMAV
DVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGLIT
SPDYPNPYPKSSECFYTIELEEGFMVSLQFEDLFDIEDHPEVPCPYDFIKIKAGSNVFGP
FCGEKAPELISTQSHSVQILFHSDNSGENRGWRLSYRAAGNECPGLRPPVHGKIEPLQTT
YSFKDQVLVSCDTGYKVLKDNVMMDTFQIECLKDGTWSNKIPTCQIVDCGAPTELEHGLV
TFSSMNNLTTYKSEIRFSCQHPYYKMLHNITGIYTCSAQGIWMNEVLGRSLPICLPVCGS
PKIHRKQMARIFNGRPAEKGTTPWIAMLSHPTDVPFCGGTLLDLNWLVTAAHCLHQPVDS
EDPRLHASYLLHPSDFKIIMGKHWRRHSDADEQHLRVKQIILHPLYNPSTFENDVALLEL
SESPTLNNFVMPICLPEEPSQEGSMVIVSGWGKQFLQRFPETLMEIEIPLVDHHTCKEAY
VPLKKKVTEDMICAGEKEGGKDACAGDSGGPMVTLDTERGRWYLVGTVSWGQGCGLKDRY
GVYSYIYHHKGWIQNVTGVKN
Download sequence
Identical sequences ENSCPOP00000014177 10141.ENSCPOP00000015878 ENSCPOP00000015878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]