SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014290 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014290
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-50
Family Calponin-homology domain, CH-domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014290   Gene: ENSCPOG00000020121   Transcript: ENSCPOT00000027241
Sequence length 306
Comment pep:known scaffold:cavPor3:scaffold_356:283466:289367:1 gene:ENSCPOG00000020121 transcript:ENSCPOT00000027241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYNPQKEAELRSWIEGLTGLAIGPDFQKGLKDGVIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNLTQV
QVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG
MTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGPADGVSSGISDGPGDSSEYPPYY
QEEAGC
Download sequence
Identical sequences A0A286XH52
XP_003460943.1.53824 ENSCPOP00000014290 ENSCPOP00000014290 10141.ENSCPOP00000014290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]