SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014311 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014311
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 81-122
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000288
Family Hairy Orange domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014311   Gene: ENSCPOG00000024138   Transcript: ENSCPOT00000027735
Sequence length 172
Comment pep:novel scaffold:cavPor3:scaffold_25:26220842:26222905:1 gene:ENSCPOG00000024138 transcript:ENSCPOT00000027735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRREGDAAELRKSLKPLLEKRRRARINDSLGQLKGLILPLLGRENSRYSKLEKADIL
EMTVHFLQELPAFSYPAIAPPPTDSYREGYRACVARLARVLPACGVLEPAVSARLLEHLR
RRSAYTTPLGQRSSWQQLPFPRTPRTSPTWAGRPETVSPPPVPHRPRCLRPW
Download sequence
Identical sequences ENSCPOP00000014311 ENSCPOP00000014311 10141.ENSCPOP00000014311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]