SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014355 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014355
Domain Number 1 Region: 11-178,224-334
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.75e-52
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014355   Gene: ENSCPOG00000019700   Transcript: ENSCPOT00000023273
Sequence length 336
Comment pep:known scaffold:cavPor3:scaffold_28:27593890:27631285:1 gene:ENSCPOG00000019700 transcript:ENSCPOT00000023273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGFLCLLPTVSDLQEEGRSAINSPMSAASVDVHPEDTQLEENEERTMIDPTSREDPKFKE
LVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLADRKLDVAEVTQSEIGQRQK
LQTVLEAVHDLLRPHGWALRWNVDSIHGKNLVSIIHLLVSLAMHFQAPIRLPEHVSVQVV
VVRKREGLLHSSHVSEELTTTTEMMMGRFERDAFDTLFDHAPDKLTVVKKSLITFVNKHL
NKLNLEVTELESQFADGVYLILLMGLLEDYFVPLHNFYLTPESFDQKVHNVAFAFELMLD
GGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Download sequence
Identical sequences 10141.ENSCPOP00000014355 ENSCPOP00000014355 ENSCPOP00000014355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]