SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014383 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014383
Domain Number 1 Region: 90-305
Classification Level Classification E-value
Superfamily L domain-like 1.43e-36
Family Ngr ectodomain-like 0.045
Further Details:      
 
Domain Number 2 Region: 786-885
Classification Level Classification E-value
Superfamily DEATH domain 1e-20
Family DEATH domain, DD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014383   Gene: ENSCPOG00000002839   Transcript: ENSCPOT00000002875
Sequence length 904
Comment pep:known scaffold:cavPor3:scaffold_218:161933:166460:1 gene:ENSCPOG00000002839 transcript:ENSCPOT00000002875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVEGLEAEEGAAAEDTARLVVEAADAQPGTSPVLAGNWLNLDLYPGGCHRLLHLCAQ
QPSPLLQVEFLQLSTHENPGLLETTLAQVPWSQLRLRSLILKGGQSRGALGVCLQGTLTT
LPAGLSGLAFLVHLDLSFNSLETLPACVPQLHGLGSLLLSYNRLSELPEALGALPTLTFL
AVTHNHLQRLPTALGALVTLKCLDLSENLLDTVPPEIGGLSNLSELNLASNRLRSLPASL
AGLQSLQILVLHSNLLTSVPAGLAHLPLLTRLDLRDNQLQNLPPDLLDTPCVCLEGNPLG
KALPAAPSPPGIPQDLEMPTLFLTSDVDSFPVTPQGCSVTLACGVRLQFPAGATAVPVTI
HYRLWLPEPSLVSLGPNDSLLSGVLELWPHGVAFQQDVSLWLLFVPPRARRCHEVVVRTR
SEDSWQDLETHLEEEAPKRLWARCQVPHFSWFLVVLRPVSNACLVPPEGTLLCSSGHPEV
KVIFPPGATEEPCHVSMQVVRIARRELRALLREPEAAVSPLLCLTQRGPAGFLCPVTVQL
PLPPGITGFSLDRSHLYLLYRAPPAATWDDITGQVPLELTHLYARFQVTHFSWYWLWYTT
KTCVEGLARKAWERLRLHQVNLIALQRRRDPEQVLLQCLPQNKVDATLRRLLERYRGPEP
SDTVEMFEGEKFFAAFERGIEVDADRPDCVEGRICFVFYSHLKNVKEVYITTSLDREAQA
VRGQVSFYRGSVPEEVALEAEAARQRKAADALWMATLPIKLPRLRGSLGHRQGPGLSLVP
LNLGDAETGFLTQSNLLSVARRLGPDWPAVALHLGLPYQELERIRHKFRDDLDGQICHML
FSWAERQAGQQGAVRCLVQALEQSDRQDVADEVRTILELGRHKYQDSIRRTGLALEDPAL
PGAS
Download sequence
Identical sequences ENSCPOP00000014383 ENSCPOP00000014383 10141.ENSCPOP00000014383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]