SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014386 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014386
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily DEATH domain 2.4e-23
Family Caspase recruitment domain, CARD 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014386   Gene: ENSCPOG00000019690   Transcript: ENSCPOT00000022114
Sequence length 88
Comment pep:novel scaffold:cavPor3:scaffold_19:8923479:8923742:-1 gene:ENSCPOG00000019690 transcript:ENSCPOT00000022114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTDMTMKEKRKQFVRSVGTGTINGLLDELLEKRVLNQEEVQIITCGNSTVMDKARALVDS
LIGKGPQACQICIDYIYEEDCHLARTLG
Download sequence
Identical sequences 10141.ENSCPOP00000014386 ENSCPOP00000014386 ENSCPOP00000014386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]