SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014425 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014425
Domain Number 1 Region: 54-150
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.44e-29
Family Cytochrome b5 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014425
Domain Number - Region: 378-435
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0334
Family Calponin-homology domain, CH-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014425   Gene: ENSCPOG00000026789   Transcript: ENSCPOT00000021250
Sequence length 481
Comment pep:known scaffold:cavPor3:scaffold_86:3545416:3577098:-1 gene:ENSCPOG00000026789 transcript:ENSCPOT00000021250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEEKPGVNGCVGGRRESCPSEMSQANGKPRANGNAKGSPKQEANGKSNAPRGCLNTYT
WQEIQKHNQDGDQWLVISRKVYDVTEWAHRHPGGPRVLNHYAGEDATDVFRAMHPNLDVV
KLYLKPLLIGELAPGEPSQERNKNPQLVEDFQELRRTLEAMNMFDGRLQFFFLHLAQILI
LEVLAWLLLYHFGNGWTVTILVSFLLTVAQAQSGFLQHDIGHLSMFKKPKWNHLMQKFVM
CHMKGLSAYWWNHRHFQHHVKTNIYPKDPDIDVGPLFVIGESQPVKYGKKKIKYIDYDKQ
HLYFYLVGLPLLMPVYFNGKSLQIMYLHKVWVDIALVSSFYIRHFITFGPFYGIFGTMLL
IYMVKFLESPWIAYVTQMSHIPMKISREENRDWLSTQVLATCNIEQSFFNDWFSGHLNFQ
IEHHLFPTMPRHNYHKVAPLVRSLCAKHGLQYVNKPLLTGFGDIVRSLKKSAALWIDSYY
E
Download sequence
Identical sequences H0VUQ0
10141.ENSCPOP00000014425 ENSCPOP00000014425 ENSCPOP00000014425 XP_003464379.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]