SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014550 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000014550
Domain Number - Region: 130-166
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0604
Family Calponin-homology domain, CH-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014550   Gene: ENSCPOG00000023826   Transcript: ENSCPOT00000028408
Sequence length 189
Comment pep:known scaffold:cavPor3:scaffold_17:32901122:32901688:1 gene:ENSCPOG00000023826 transcript:ENSCPOT00000028408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVATDVFNSKNLAVQAQKKILGKMASKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAE
RVIKHLIKTVIKLAILYRNSQFNQEELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLS
KLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGI
NKMLDEENI
Download sequence
Identical sequences ENSCPOP00000014550 10141.ENSCPOP00000014550 ENSCPOP00000014550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]