SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014591 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014591
Domain Number 1 Region: 78-207
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.66e-44
Family Regulator of G-protein signaling, RGS 0.000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014591   Gene: ENSCPOG00000023781   Transcript: ENSCPOT00000027690
Sequence length 217
Comment pep:known scaffold:cavPor3:scaffold_119:300211:302228:1 gene:ENSCPOG00000023781 transcript:ENSCPOT00000027690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTPNEAEKQHTGPEEADRPPSMSSHDTAPRPAPSRNPTPTLISRFCTKTKRNQERRRTW
KASHDSKLQPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLF
WLACEELKTEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSAHTFDD
AQLQIYTLMHRDSYPRFLSSPTYRALLLPERPQSSEA
Download sequence
Identical sequences ENSCPOP00000014591 10141.ENSCPOP00000014591 ENSCPOP00000014591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]