SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014611 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014611
Domain Number 1 Region: 265-506
Classification Level Classification E-value
Superfamily Caspase-like 3.29e-80
Family Caspase catalytic domain 0.000000756
Further Details:      
 
Domain Number 2 Region: 18-127
Classification Level Classification E-value
Superfamily DEATH domain 6.94e-23
Family DEATH effector domain, DED 0.003
Further Details:      
 
Domain Number 3 Region: 115-184
Classification Level Classification E-value
Superfamily DEATH domain 0.000000033
Family DEATH effector domain, DED 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014611   Gene: ENSCPOG00000024282   Transcript: ENSCPOT00000026126
Sequence length 512
Comment pep:novel scaffold:cavPor3:scaffold_104:633684:658575:-1 gene:ENSCPOG00000024282 transcript:ENSCPOT00000026126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRQSLGSSPEEQSGMHFQEMLLNIDSNLTAQDVEGLKFLCTGLVFEKRLESCSSALD
LFDLLLVQELFREDDPFFLAELLYVIKQHALLSRLGYTRESVEQQLPARGRLSLFRKLLY
ELSEAISTFLLRNQIPKAQMTSLGLLLCLEKNRVIEEDNLSVLEEVFTKVIPSLGKKIEN
YKREEAAQKAMSPADLRPGEEEVFSGSDVKQFLAALPNIFPFWLGKSSGANFSRSRGGSP
TIFQQLVSGGSAGQLRSKSVAKEADVYRMDRKHRGHCVIINNCNFQGSLSERQGTHVDAE
DLRRVFQWLGFTVHTYHDVTGEGMQRILEEQKNNPGHVDGDCFVCCILTHGELGGIYASD
WVFIRLQEITAHFTAQRCRGLAHKPKLFFIQACQGKEEHPSVLVEADALNPEQVSPTLQG
AIPDEADFLLGLATVPGYVSFRHKEDGSWYIQSLCKHLKNLVPRQQDILSILTAVNCDVS
QRADSTGKKKQMPQPAFTLRKKLVFPVPPEAL
Download sequence
Identical sequences ENSCPOP00000014611 ENSCPOP00000014611 10141.ENSCPOP00000014611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]