SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014661 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014661
Domain Number 1 Region: 45-383
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.53e-86
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000285
Further Details:      
 
Domain Number 2 Region: 387-550
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.35e-27
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014661   Gene: ENSCPOG00000025973   Transcript: ENSCPOT00000024597
Sequence length 581
Comment pep:known scaffold:cavPor3:scaffold_104:3089040:3090818:-1 gene:ENSCPOG00000025973 transcript:ENSCPOT00000024597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRISVFQALRLLAASRVPLLGGPGARCYGSGGPTVGSNAAHPHDFFTTPIFYVNAAPHI
GHLYSALLGDALCRHRSLRAPSGAAARLSTGTDEHGLKIQLLCDRVSAQFRRLFRDAGVA
ATDFFRTTEARHQEAVQHFWEVLAARGLLYKGLYEGWYCSSDECFLPEAKVTRQPGPSGE
SCPVSLESGHPVSWTEEENYIFRLSQFREPVQRWLRSNPRAIVPEPFHRLVLQWLEEELP
DLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVSYLTVIGYPNAEFRSWWPASQVIGKDI
LKFHAIYWPALLLGAGLNPPRRIYVHSHWTVCGQKMSKSLGNVVDPVACLDRYTVDGFRY
FLLRQGVPNWDCDYNDEKVVKLLDSELADALGGLLNRCTAGRINPSGTYPAFCTACFPTE
PGSQGPAVRAQAEDYALLNAVAALPEQVANYYDNFQIYKALEAVSSCVRQTNGFVQRHAP
WKLSWESPRDAPWLGTVLHVAFECLRVFGTLLQPVTPSLADKLLSRLGVSAAERGLQQLF
FLPRFYGRQCPFEGRRLGPETGLLFPRLDQSRVRMVKAQGT
Download sequence
Identical sequences 10141.ENSCPOP00000014661 ENSCPOP00000014661 ENSCPOP00000014661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]