SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014665 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000014665
Domain Number - Region: 2-43
Classification Level Classification E-value
Superfamily DEATH domain 0.008
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 
Domain Number - Region: 784-898
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00903
Family Nucleotide and nucleoside kinases 0.0094
Further Details:      
 
Domain Number - Region: 206-353
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0356
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014665   Gene: ENSCPOG00000020172   Transcript: ENSCPOT00000026073
Sequence length 912
Comment pep:known scaffold:cavPor3:scaffold_28:21988207:22009489:-1 gene:ENSCPOG00000020172 transcript:ENSCPOT00000026073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRLMDILRCRGRGYEAFLEALEFYYPEHYTLLTGREPAQRCSMILDEEGPEGLTQFLMTE
VRRLREARKAQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQ
LAVDQLKLKVSRLEEECALLRRARGPLPGADEKEREPDSVDLVSELRAENQRLTASLQEL
QEGLQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDKYL
QEMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKD
QYRKQVRGLEAERDKLLTTLTTLEGTKALLEAQLQRSQGGSSLKACTSSHSLCSNFSSTW
SLSDFPSPLGGPEAAGEVREVTIAGGSEPHTSEEATDSEKEINRLSILPFPPSAGSILRR
QREEDPEPPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLGRGPGLGLL
NRSLAFRMSGWSPSGGQESQDKGPDGLPFGGDRWPGAVVRRVLSGPGSARTEPCEPRAEG
AGLEGAGLEAETQQRSLVCTLPSRLDSKACQSFHEALDAWAKRPGSEPFYIRANLTLAER
ADPHALSVKAQEILRLVDPAYKRRQEWFCTRVDPLTLRDLDRGTVPNYQRAQQLLEVQEK
CQSSSRHRSPRSNLKKRALGLVRPKPVGGPAGDPSEQLLPEPCSEPERSLKPYSLVRPLL
VSALRPVVLLPECLASRLIRNLLDLPSSRLDFQVCSAESLSGEEQCSPSAPGAPKARPTT
PGLGSRIRTIQELVGKKKHCLLELGVRGVRELVQNDVYPIVIHVEVTEKNIREVRGLLGR
PGARDSELLRQCRSVEQALWGLPCSWVQVPAHAWGHAEELAKVVRGRILQEQARLVWVER
GSSGGSGSCSEA
Download sequence
Identical sequences ENSCPOP00000014665 10141.ENSCPOP00000014665 ENSCPOP00000014665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]