SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015034 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015034
Domain Number 1 Region: 44-99
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000437
Family TNF receptor-like 0.0017
Further Details:      
 
Domain Number 2 Region: 99-159
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000673
Family TNF receptor-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015034   Gene: ENSCPOG00000023976   Transcript: ENSCPOT00000025901
Sequence length 195
Comment pep:novel scaffold:cavPor3:scaffold_42:11473543:11480039:1 gene:ENSCPOG00000023976 transcript:ENSCPOT00000025901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGPCCALCACLSCWSRYSRVHHCFIILLLDESLPIGYSGLESCNSDEYMNAGRCCKMCP
AGQYVEKPCMRPHTQGVCVKCEPGTYTAYANGLESCLLCSTCRADQEVVRKCSPTNDQKC
ECKQGYFSEDTGCLEHCTPCDKCPDETAVLRECNATSNTVCRAAHSEKRNRLYTFLCIIP
LLGSIAFFCFLMKRR
Download sequence
Identical sequences ENSCPOP00000015034 10141.ENSCPOP00000015034 ENSCPOP00000015034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]