SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015216 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015216
Domain Number 1 Region: 121-193
Classification Level Classification E-value
Superfamily Homeodomain-like 4.06e-24
Family Homeodomain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015216   Gene: ENSCPOG00000024932   Transcript: ENSCPOT00000028155
Sequence length 231
Comment pep:novel scaffold:cavPor3:scaffold_1:60185583:60188610:-1 gene:ENSCPOG00000024932 transcript:ENSCPOT00000028155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSPATSTPFSVEDILRLEREPGDFQASPQKEDSEVTLKPSACQEDPKGRRGNSSKKPG
THTFTELQAEIPSKETPLCSPRKECLAPSHFGTDEYTADHRGAQLCSGRFQSDRARSGDR
VCGGGPEQPRTRQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREQLARALQLTSTQVKI
WFQNRRYKCKRQRQDKSLELAGHSLAPRRVAVPVLVRDGRPCLGPGASAFP
Download sequence
Identical sequences ENSCPOP00000015216 ENSCPOP00000015216 10141.ENSCPOP00000015216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]