SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015310 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015310
Domain Number 1 Region: 67-374
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.6e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 361-471
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.57e-16
Family Anticodon-binding domain of Class II aaRS 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015310   Gene: ENSCPOG00000025477   Transcript: ENSCPOT00000022590
Sequence length 475
Comment pep:known scaffold:cavPor3:scaffold_88:5441348:5442775:1 gene:ENSCPOG00000025477 transcript:ENSCPOT00000022590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLLVRCRAWPRLATRTPQLCRPFLYRCQHCAPGRGQRLVLSGMFQPQNLREDQVLSLE
DRPSNLTCKSQRLMLQGGLILPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKIDMP
SLCPAELWRATSRWQLMAKELLRLRDRHGKEYCLGPTHEEAVTALVASQKNLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAARQTYSLVCDAYCSLFNRLGLR
FIKAQADVGSIGGTMSHEFQLPVDIGEDQLVICPSCSFSANKETLDSLQTNCPACQGPLT
ETKGIEVGHTFYLGTKYSSIFSAQFANAHGELSLAEMGCYGLGVTRILAAALEVLSTEDC
IRWPSLLAPYQVCLIPPKKGSKEAAATELVEQLHDHIIERAPQLRGEVVLDDRTHLTIGS
RLKDAHKLGYPFVIIAGKRALEVPAHFEVWCQNTGEVVFLTQEGIAELLAQVQVV
Download sequence
Identical sequences H0VX81
ENSCPOP00000015310 ENSCPOP00000015310 XP_005001132.1.53824 XP_013001702.1.53824 10141.ENSCPOP00000015310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]